discontinued

P6015 sspA (Staphylococcus aureus)

Search for all "sspA (Staphylococcus aureus)"

Vue générale rapide

sspA (Staphylococcus aureus)

P6015

Description du Produit sspA (Staphylococcus aureus)

sspA (Staphylococcus aureus).

Caractéristiques du Produit sspA (Staphylococcus aureus)

Type de Produit Proteins & Growth Factors
Quantité 50 µg
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
P09332
Add. information Escherichia coli
Applications Func, SDS-PAGE
Stockage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
Séquence AA:
LPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNG GFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLK GEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPDNPDNP NNPDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA
Presentation
Buffer:
Lyophilized from solutions contain no sodiun azide nor carrier protein.
Format:
Lyophilized
  • LinkedIn