TA342540 ZNF420 anticorps

Rabbit Polyclonal Anti-ZNF420 Antibody

See related secondary antibodies

Search for all "ZNF420"

50 µg / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Vue générale rapide

Rabbit anti Canine, Equine, Human ZNF420

Description du Produit ZNF420

Rabbit anti Canine, Equine, Human ZNF420.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit ZNF420

Type de Produit Anticorps Primaires
Target Category
Quantité 50 µg
Synonymes Zinc finger protein 420
Presentation Purified
Reactivité d'Espèce Can, Eq, Hu
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur OriGene Technologies, Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q8TAQ5
Immunogène:
The immunogen for anti-ZNF420 antibody: synthetic peptide directed towards the N terminal of human ZNF420. Synthetic peptide located within the following region: LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN.
GeneID:
147923
Applications WB
Sujet May be involved in transcriptiol regulation.
Presentation
Buffer:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 297% sucrose.
Format:
Purified

Accessory Products

  • LinkedIn