discontinued

H00007280-M05 TUBB2A anticorps

See related secondary antibodies

Search for all "TUBB2A"

Vue générale rapide

Mouse anti Human TUBB2A 3F9

H00007280-M05

Plus de vues

  • H00007280-M05
  • H00007280-M05

Description du Produit TUBB2A

Mouse anti Human TUBB2A 3F9.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Caractéristiques du Produit TUBB2A

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 mg
Synonymes TUBB2, Tubulin beta-2A chain
Presentation Purified
Reactivité d'Espèce Hu
Applications E, ICC/IF, P, WB
Clonalité Monoclonal
Clone 3F9
Hôte Mouse
Isotype IgG2a
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q13885
Immunogène:
TUBB2A (AAH01194, 1 a.a. ~ 446 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Séquence AA:
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSV RSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLI SKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHL VSATMSGVTTCLRFPGQLNADLRKLAV
GeneID:
7280
Remarques:
Gene Accession: BC001194
Isotype Control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full-length recombinant TUBB2A.

Antibody Reactive Against Recombinant Protein.
Applications ELISA,IF,IHC-P,WB-Ce,WB-Re
Stockage In 1x PBS, pH 7.2
Presentation
Conjugation:
None
Purification:
Purified
Buffer:
In 1x PBS, pH 7.2
Pureté:
Purified
Format:
Purified
Specificité
Espèces:
Human
ID Gène 7280

Accessory Products

Protéines et/ou Positive Controls

Protéines pour TUBB2A (7 produits)

N° du Produit Espèces Presentation Pureté   Source  

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive Controls pour TUBB2A (2 produits)

N° du Produit Espèces Presentation Pureté   Source  

beta II Tubulin A Lysate

Western Blot: beta II Tubulin A Lysate [NBL1-17437]
  Novus Biologicals Inc.

TUBB (Tubulin beta chain) Lysate(Denatured)

TUBB (Tubulin beta chain) Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn