discontinued

H00010953-M01 TOMM34 anticorps

See related secondary antibodies

Search for all "TOMM34"

Vue générale rapide

Mouse anti Human TOMM34 2B5

H00010953-M01

Plus de vues

  • H00010953-M01
  • H00010953-M01

Description du Produit TOMM34

Mouse anti Human TOMM34 2B5.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Caractéristiques du Produit TOMM34

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 mg
Synonymes Mitochondrial import receptor subunit TOM34, TOM34, Translocase of outer membrane 34 kDa subunit, URCC3
Presentation Purified
Reactivité d'Espèce Hu
Applications E, ICC/IF, WB
Clonalité Monoclonal
Clone 2B5
Hôte Mouse
Isotype IgG2a
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q15785
Immunogène:
TOMM34 (AAH01763, 1 a.a. ~ 310 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Séquence AA:
MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTS ALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPV SAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESA TYSNRALCYLVLKQYTEAVKDCTEALK
GeneID:
10953
Remarques:
Gene Accession: BC001763
Isotype Control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full length recombinant TOMM34.

Antibody Reactive Against Recombinant Protein.
Applications ELISA,IF,S-ELISA,WB-Ce,WB-Re
Stockage In 1x PBS, pH 7.2
Presentation
Conjugation:
None
Purification:
Purified
Buffer:
In 1x PBS, pH 7.2
Pureté:
Purified
Format:
Purified
Specificité
Espèces:
Human
ID Gène 10953

Accessory Products

Protéines et/ou Positive Controls

Protéines pour TOMM34 (5 produits)

N° du Produit Espèces Presentation Pureté   Source  

TOMM34

TOMM34 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

TOMM34 (1-309, His-tag)

TOMM34 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / 820,00 €
  OriGene Technologies GmbH

TOMM34 (1-309, His-tag)

TOMM34 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / 320,00 €
  OriGene Technologies GmbH

TOMM34

TOMM34 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TOMM34

TOMM34 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive Controls pour TOMM34 (3 produits)

N° du Produit Espèces Presentation Pureté   Source  

TOMM34 293T Cell Transient Overexpression Lysate(Denatured)

TOMM34 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TOMM34 Lysate

Western Blot: TOMM34 Lysate [NBL1-17191] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TOMM34
  Novus Biologicals Inc.

TOMM34 overexpression lysate

TOMM34 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn