discontinued

NBP1-91021 TMEM61 anticorps

See related secondary antibodies

Search for all "TMEM61"

Vue générale rapide

Rabbit anti Human TMEM61

Description du Produit TMEM61

Rabbit anti Human TMEM61.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Caractéristiques du Produit TMEM61

Type de Produit Anticorps Primaires
Quantité 0.1 ml
Presentation Aff - Purified
Reactivité d'Espèce Hu
Applications P
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Not USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q8N0U2
Immunogène:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PRWDPYHLSRDLYYLTVESSEKESCRTPKVVDIPTYEEAVSFPVAEGPPTPPAYPTEEALEPSGSRDALLSTQPAWPPPSYESISLALDAVSAETTPSATRSCSGLVQTARG
GeneID:
199964
Stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Presentation
Purification:
Affinity purified
Buffer:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
Format:
Aff - Purified
ID Gène 199964

Accessory Products

Protéines et/ou Positive Controls

Positive Controls pour TMEM61 (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

TMEM61 overexpression lysate

TMEM61 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn