discontinued

NBP1-59813 Sodium Potassium ATPase Beta 1 anticorps

See related secondary antibodies

Search for all "Sodium Potassium ATPase Beta 1"

Vue générale rapide

Rabbit anti Human Sodium Potassium ATPase Beta 1

Description du Produit Sodium Potassium ATPase Beta 1

Rabbit anti Human Sodium Potassium ATPase Beta 1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit Sodium Potassium ATPase Beta 1

Type de Produit Anticorps Primaires
Quantité 50 µg
Synonymes ATP1B, MGC1798
Presentation Aff - Purified
Reactivité d'Espèce Hu
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Destination Europe only
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
A6NGH2
Immunogène:
Synthetic peptides corresponding to ATP1B1(ATPase, Na+/K+ transporting, beta 1 polypeptide) The peptide sequence was selected from the N terminal of ATP1B1. Peptide sequence RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD.
Sujet ATP1B1 belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K io
Stockage Store at -20C. Avoid freeze-thaw cycles.
Presentation
Purification:
Peptide affinity purified
Buffer:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Format:
Aff - Purified

Accessory Products

  • LinkedIn