NBP1-59813 Sodium Potassium ATPase Beta 1 anticorps

See related secondary antibodies

Search for all "Sodium Potassium ATPase Beta 1"

Vue générale rapide

Rabbit anti Human Sodium Potassium ATPase Beta 1

Description du Produit Sodium Potassium ATPase Beta 1

Rabbit anti Human Sodium Potassium ATPase Beta 1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit Sodium Potassium ATPase Beta 1

Type de Produit Anticorps Primaires
Quantité 50 µg
Synonymes ATP1B, MGC1798
Presentation Aff - Purified
Reactivité d'Espèce Hu
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Destination Europe only
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Swiss Prot:
Synthetic peptides corresponding to ATP1B1(ATPase, Na+/K+ transporting, beta 1 polypeptide) The peptide sequence was selected from the N terminal of ATP1B1. Peptide sequence RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD.
Sujet ATP1B1 belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K io
Stockage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn