TA333710 SLC26A1 / SAT1 anticorps

Rabbit Polyclonal Anti-SLC26A1 Antibody

See related secondary antibodies

Search for all "SLC26A1 / SAT1"

50 µg / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Vue générale rapide

Rabbit anti Human SLC26A1 / SAT1


Plus de vues

  • TA333710

Description du Produit SLC26A1 / SAT1

Rabbit anti Human SLC26A1 / SAT1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Caractéristiques du Produit SLC26A1 / SAT1

Type de Produit Anticorps Primaires
Target Category
Quantité 50 µg
Synonymes SAT-1, Solute carrier family 26 member 1, Sulfate anion transporter 1
Presentation Purified
Reactivité d'Espèce Hu
Applications P, WB
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur OriGene Technologies, Inc.

Extrait de la Fiche Technique

Swiss Prot:
The immunogen for Anti-SLC26A1 Antibody: synthetic peptide directed towards the C terminal of human SLC26A1. Synthetic peptide located within the following region: LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA.
Applications WB
Sujet SLC26A1 is a member of sulfate/anion transporter family. Family members are well conserved in their protein (aa length among species) structures, but have markedly different tissue expression patterns. Its gene is primarily expressed in the liver, pancreas, and brain.This gene is a member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures, but have markedly different tissue expression patterns. This gene is primarily expressed in the liver, pancreas, and brain. Three splice variants that encode different isoforms have been identified.
Affinity Purified
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Protéines et/ou Positive Controls

Positive Controls pour SLC26A1 / SAT1 (2 produits)

N° du Produit Espèces Presentation Pureté   Source  

SLC26A1 overexpression lysate

SLC26A1 overexpression lysate
0.1 mg / 495,00 €
  OriGene Technologies, Inc.

SLC26A1 overexpression lysate

SLC26A1 overexpression lysate
0.1 mg / 495,00 €
  OriGene Technologies, Inc.
  • LinkedIn