discontinued

NBP1-52827 ROR alpha anticorps

See related secondary antibodies

Search for all "ROR alpha"

Vue générale rapide

Rabbit anti Human, Mouse, Rat ROR alpha

Description du Produit ROR alpha

Rabbit anti Human, Mouse, Rat ROR alpha.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit ROR alpha

Type de Produit Anticorps Primaires
Quantité 50 µg
Synonymes MGC119326, MGC119329, NR1F1, ROR1, ROR2, ROR3, RZRA
Presentation Aff - Purified
Reactivité d'Espèce Hu, Ms, Rt
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Destination Europe only
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
B6ZGS4
Immunogène:
Synthetic peptides corresponding to RORA(RAR-related orphan receptor A) The peptide sequence was selected from the N terminal of RORA. Peptide sequence ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY.
Sujet The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Four transcript variants encoding different isoforms have been described for this gene.
Stockage Store at -20C. Avoid freeze-thaw cycles.
Presentation
Purification:
Peptide affinity purified
Buffer:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Format:
Aff - Purified

Accessory Products

  • LinkedIn