discontinued

NBP1-55342 Rabex5 anticorps

See related secondary antibodies

Search for all "Rabex5"

Vue générale rapide

Rabbit anti Human Rabex5

NBP1-55342

Description du Produit Rabex5

Rabbit anti Human Rabex5.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit Rabex5

Type de Produit Anticorps Primaires
Quantité 50 µg
Synonymes FLJ32302, RABEX5, rabex-5
Presentation Aff - Purified
Reactivité d'Espèce Hu
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Destination Europe only
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
A8K3R3
Immunogène:
Synthetic peptides corresponding to RABGEF1(RAB guanine nucleotide exchange factor (GEF) 1) The peptide sequence was selected from the N terminal of RABGEF1. Peptide sequence MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ.
Sujet RABGEF1 forms a complex with rabaptin-5 (RABPT5; MIM 603616) that is required for endocytic membrane fusion, and it serves as a specific guanine nucleotide exchange factor (GEF) for RAB5 (RAB5A; MIM 179512) (Horiuchi et al., 1997 [PubMed 9323142]).
Stockage Store at -20C. Avoid freeze-thaw cycles.
Presentation
Purification:
Peptide affinity purified
Buffer:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Format:
Aff - Purified

Accessory Products

  • LinkedIn