discontinued

NBP1-93810 PROX2 anticorps

See related secondary antibodies

Search for all "PROX2"

Vue générale rapide

Rabbit anti Human PROX2

NBP1-93810

Plus de vues

  • NBP1-93810

Description du Produit PROX2

Rabbit anti Human PROX2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Caractéristiques du Produit PROX2

Type de Produit Anticorps Primaires
Quantité 0.1 ml
Presentation Aff - Purified
Reactivité d'Espèce Hu
Applications P, WB
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Not USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q3B8N5
Immunogène:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VLLDPPGHLTQLGRSFQGQVAEGRSEPSPPVGGACKDPLALAALPRRVQLQAGVPVGNLSLAKRLDSPRYPIPPRMTPKPCQDP
GeneID:
283571
Stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Presentation
Purification:
Affinity purified
Buffer:
Phospate buffered saline, pH 7.2, containing 40% glycerol
Format:
Aff - Purified
ID Gène 283571

Accessory Products

Protéines et/ou Positive Controls

Positive Controls pour PROX2 (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

PROX2 overexpression lysate

PROX2 overexpression lysate
0.1 mg / 480,00 €
  OriGene Technologies, Inc.
  • LinkedIn