discontinued

NBP1-90721 PLAC8 anticorps

See related secondary antibodies

Search for all "PLAC8"

Vue générale rapide

Rabbit anti Human PLAC8

NBP1-90721

Plus de vues

  • NBP1-90721

Description du Produit PLAC8

Rabbit anti Human PLAC8.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Caractéristiques du Produit PLAC8

Type de Produit Anticorps Primaires
Quantité 0.1 ml
Presentation Aff - Purified
Reactivité d'Espèce Hu
Applications P, WB
Clonalité Polyclonal
Hôte Rabbit
Destination Not USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q9NZF1
Immunogène:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF
GeneID:
51316
Stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Presentation
Purification:
Affinity purified
Buffer:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
Format:
Aff - Purified
ID Gène 51316

Accessory Products

Protéines et/ou Positive Controls

Protéines pour PLAC8 (4 produits)

N° du Produit Espèces Presentation Pureté   Source  

PLAC8 (1-115, His-tag)

PLAC8 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / 730,00 €
  OriGene Technologies GmbH

PLAC8 (1-115, His-tag)

PLAC8 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / 300,00 €
  OriGene Technologies GmbH

Placenta-specific 8 (PLAC8), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug (full length, N-term HIS tag, transcript variant 2)

Placenta-specific 8 (PLAC8), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / 199,00 €
  OriGene Technologies, Inc.

Placenta-specific 8 (PLAC8), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug (full length, N-term HIS tag, transcript variant 3)

Placenta-specific 8 (PLAC8), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / 199,00 €
  OriGene Technologies, Inc.
  • LinkedIn