discontinued

NBP1-74255 PKI-beta anticorps

See related secondary antibodies

Search for all "PKI-beta"

Vue générale rapide

Rabbit anti Rat PKI-beta

NBP1-74255

Description du Produit PKI-beta

Rabbit anti Rat PKI-beta.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit PKI-beta

Type de Produit Anticorps Primaires
Quantité 50 µg
Presentation Aff - Purified
Reactivité d'Espèce Rt
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Destination Europe only
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q8R4R3
Immunogène:
Synthetic peptides corresponding to the middle region of Pkib. Immunizing peptide sequence TDVESVISSFASSARAGRRNALPDIQSSLATGGSPDLALKLEALAVKEDA.
GeneID:
24678
Sujet Pkib displays strong inhibition of the activity of cAMP-dependent protein kinase.
Stockage Store at -20C. Avoid freeze-thaw cycles.
Presentation
Purification:
Peptide affinity purified
Buffer:
This product is lyophilized and contains PBS and 2% Sucrose.
Format:
Aff - Purified
ID Gène 24678

Accessory Products

  • LinkedIn