discontinued

H00010215-M03 OLIG2 anticorps

See related secondary antibodies

Search for all "OLIG2"

Vue générale rapide

Mouse anti Human OLIG2 3C9

Description du Produit OLIG2

Mouse anti Human OLIG2 3C9.
Presentation: Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Caractéristiques du Produit OLIG2

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 mg
Synonymes BHLHB1, Class B basic helix-loop-helix protein 1, OLIG2, Oligo2, Oligodendrocyte transcription factor 2, PRKCBP2, Protein kinase C-binding protein 2, Protein kinase C-binding protein RACK17, RACK17, bHLHB1
Presentation Purified
Reactivité d'Espèce Hu
Applications E, ICC/IF, P, WB
Clonalité Monoclonal
Clone 3C9
Hôte Mouse
Isotype IgG2a
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q13516
Immunogène:
OLIG2 (NP_005797, 2 a.a. ~ 78 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Séquence AA:
DSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKS S
GeneID:
10215
Remarques:
Gene Accession: NM_005806
Isotype Control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full length recombinant OLIG2.

Antibody Reactive Against Recombinant Protein.
Applications ELISA,IHC-P,WB-Re
Stockage In 1x PBS, pH 7.2
Presentation
Conjugation:
None
Purification:
Purified
Buffer:
In 1x PBS, pH 7.2
Pureté:
Purified
Format:
Purified
Specificité
Espèces:
Human
ID Gène 10215
FocusOn et Revues
FocusOns:

Accessory Products

Protéines et/ou Positive Controls

Protéines pour OLIG2 (3 produits)

N° du Produit Espèces Presentation Pureté   Source  

OLIG2

OLIG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 438,00 €
  OriGene Technologies, Inc.

OLIG2

OLIG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

OLIG2

OLIG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive Controls pour OLIG2 (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

OLIG2 293T Cell Transient Overexpression Lysate(Denatured)

OLIG2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn