discontinued

H00408050-M03 NOMO3 anticorps

See related secondary antibodies

Search for all "NOMO3"

Vue générale rapide

Mouse anti Human NOMO3 5A7

H00408050-M03

Description du Produit NOMO3

Mouse anti Human NOMO3 5A7.
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Caractéristiques du Produit NOMO3

Type de Produit Anticorps Primaires
Quantité 0.1 mg
Synonymes Nomo
Reactivité d'Espèce Hu
Applications E, WB
Clonalité Monoclonal
Clone 5A7
Hôte Mouse
Isotype IgG2a
Destination Worldwide
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
P69849
Immunogène:
NOMO3 (NP_001004067.1, 966 a.a. ~ 1033 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Séquence AA:
TVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHH
GeneID:
408050
Add. information Mouse monoclonal antibody raised against a partial recombinant NOMO3.
Stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Presentation
Buffer:
In 1x PBS, pH 7.2
Specificité
Specificité:
Antibody Reactive Against Recombinant Protein.

Accessory Products

Protéines et/ou Positive Controls

Protéines pour NOMO3 (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

NODAL modulator 3 (NOMO3)

NODAL modulator 3 (NOMO3) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.
  • LinkedIn