discontinued

NBP1-90522 NOL11 anticorps

See related secondary antibodies

Search for all "NOL11"

Vue générale rapide

Rabbit anti Human NOL11

NBP1-90522

Plus de vues

  • NBP1-90522
  • NBP1-90522

Description du Produit NOL11

Rabbit anti Human NOL11.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Caractéristiques du Produit NOL11

Type de Produit Anticorps Primaires
Quantité 0.1 ml
Presentation Aff - Purified
Reactivité d'Espèce Hu
Applications ICC/IF, P, WB
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Not USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q9H8H0
Immunogène:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: FTLSSVVLSAGPEGLLGVEQSDKTDQFLVTDSGRTVILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGEYVVVHDNKVLRIWNNEDVNL
GeneID:
25926
Stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Presentation
Purification:
Affinity purified
Buffer:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
Format:
Aff - Purified
ID Gène 26005

Accessory Products

  • LinkedIn