discontinued

H00003084-D01P Neuregulin 1 anticorps

See related secondary antibodies

Search for all "Neuregulin 1"

Vue générale rapide

Rabbit anti Human Neuregulin 1

H00003084-D01P

Plus de vues

  • H00003084-D01P

Description du Produit Neuregulin 1

Rabbit anti Human Neuregulin 1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Caractéristiques du Produit Neuregulin 1

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 mg
Synonymes Acetylcholine receptor-inducing activity, Breast cancer cell differentiation factor p45, GGF, Glial growth factor, HGL, HRG, HRGA, Heregulin, NDF, NRG1, Neu differentiation factor, Pro-neuregulin-1 membrane-bound isoform, SMDF, Sensory and motor neuron-derived factor
Presentation Purified
Reactivité d'Espèce Hu
Applications E(detection), WB
Clonalité Polyclonal
Hôte Rabbit
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q02297
Immunogène:
NRG1 (NP_039252.1, 1 a.a. ~ 241 a.a) full-length human protein.
Séquence AA:
MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPQLKEMKSQESAAGSKLVLRCETSSEYSSLRFKWFKNGNE LNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSES PIRISVSTEGANTSSSTSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMAS FYSTSTPFLSLPE
GeneID:
3084
Remarques:
Gene Accession: NM_013958.1
Add. information Rabbit polyclonal antibody raised against a full-length human NRG1 protein.

Antibody reactive against mammalian transfected lysate.
Applications Det Ab,WB-Ti,WB-Tr
Stockage In 1x PBS, pH 7.2
Presentation
Conjugation:
None
Purification:
Purified
Buffer:
In 1x PBS, pH 7.2
Pureté:
Purified
Format:
Purified
Specificité
Espèces:
Human
ID Gène 3084

Accessory Products

Protéines et/ou Positive Controls

Protéines pour Neuregulin 1 (13 produits)

N° du Produit Espèces Presentation Pureté   Source  

Neuregulin 1 (transcript variant GGF2)

Neuregulin 1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / 230,00 €
  OriGene Technologies, Inc.

Neuregulin 1 (beta-1 Isoform)

Neuregulin 1 Human Purified > 98 % > 98 % by SDS-PAGE gel and HPLC analyses E. coli
  OriGene Technologies GmbH

Neuregulin 1 (beta-1 Isoform)

Neuregulin 1 Human Purified > 98 % > 98 % by SDS-PAGE gel and HPLC analyses E. coli
  OriGene Technologies GmbH

Neuregulin 1

Neuregulin 1 Human Purified
  Abnova Taiwan Corp.

Neuregulin 1

Neuregulin 1 Human Purified
  Abnova Taiwan Corp.

Neuregulin 1

Neuregulin 1 Human
  Abnova Taiwan Corp.

Neuregulin 1

Neuregulin 1 Human
  Abnova Taiwan Corp.

Neuregulin 1

Neuregulin 1 Human
  Abnova Taiwan Corp.

Neuregulin 1

 Heregulin-B2 structure and sequence Human Purified > 95 % E. coli
10 µg / 310,00 €
  Neuromics Antibodies

Neuregulin 1

 Heregulin-B2 structure and sequence Human Purified > 95 % E. coli
50 µg / 440,00 €
  Neuromics Antibodies

Neuregulin 1

Functional Assay: Neuregulin 1 Protein [NBC1-21353] - The bioactivity was determined by dose-dependent cell proliferation assay for MCF-7 cells. ED50 for this NovActive™ NRG1 LOT lies in the range of 0.9-1.3 ng/ml. Affinity purified
  Novus Biologicals Inc.

Neuregulin 1

Neuregulin 1 Affinity purified
  Novus Biologicals Inc.

Neuregulin 1

Neuregulin 1 Affinity purified
  Novus Biologicals Inc.

Positive Controls pour Neuregulin 1 (4 produits)

N° du Produit Espèces Presentation Pureté   Source  

NRG1 293T Cell Transient Overexpression Lysate(Denatured)

NRG1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NRG1 293T Cell Transient Overexpression Lysate(Denatured)

NRG1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NRG1 Lysate

Western Blot: NRG1 Lysate [NBL1-13790] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NRG1
  Novus Biologicals Inc.

NRG1 overexpression lysate

NRG1 overexpression lysate
0.1 mg / 315,00 €
  OriGene Technologies, Inc.
  • LinkedIn