TA344712 NAP1L2 / BPX anticorps

Rabbit Polyclonal Anti-NAP1L2 Antibody - middle region

See related secondary antibodies

Search for all "NAP1L2 / BPX"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Vue générale rapide

Rabbit anti Canine, Equine, Human, Rabbit, Rat NAP1L2 / BPX

Description du Produit NAP1L2 / BPX

Rabbit anti Canine, Equine, Human, Rabbit, Rat NAP1L2 / BPX.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit NAP1L2 / BPX

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 ml
Synonymes Brain-specific protein X-linked, Nucleosome assembly protein 1-like 2
Presentation Purified
Reactivité d'Espèce Can, Eq, Hu, Rb, Rt
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur OriGene Technologies, Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q9ULW6
Immunogène:
The immunogen for anti-NAP1L2 antibody: synthetic peptide directed towards the middle region of human NAP1L2. Synthetic peptide located within the following region: VDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNE.
GeneID:
4674
Applications WB
Sujet This gene encodes a member of the nucleosome assembly protein (P) family. The function of this family member is unknown; however, mouse studies suggest that it represents a class of tissue-specific factors interacting with chromatin to regulate neurol cell proliferation.
Presentation
Purification:
Affinity Purified
Buffer:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Format:
Purified

Accessory Products

Protéines et/ou Positive Controls

Protéines pour NAP1L2 / BPX (6 produits)

N° du Produit Espèces Presentation Pureté   Source  

NAP1L2 / BPX

NAP1L2 / BPX Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

NAP1L2 / BPX

NAP1L2 / BPX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NAP1L2 / BPX

NAP1L2 / BPX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NAP1L2 / BPX

NAP1L2 / BPX Human Purified
  Abnova Taiwan Corp.

NAP1L2 / BPX

NAP1L2 / BPX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NAP1L2 / BPX

NAP1L2 / BPX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive Controls pour NAP1L2 / BPX (2 produits)

N° du Produit Espèces Presentation Pureté   Source  

NAP1L2 293T Cell Transient Overexpression Lysate(Denatured)

NAP1L2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NAP1L2 overexpression lysate

NAP1L2 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn