discontinued

NBP1-94167 MYEOV2 anticorps

See related secondary antibodies

Search for all "MYEOV2"

Vue générale rapide

Rabbit anti Human MYEOV2

Description du Produit MYEOV2

Rabbit anti Human MYEOV2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Caractéristiques du Produit MYEOV2

Type de Produit Anticorps Primaires
Quantité 0.1 ml
Presentation Aff - Purified
Reactivité d'Espèce Hu
Applications P
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Not USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q8WXC6
Immunogène:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ATSEGKMGTGRLRNSLRKNQSKWLGSYLEVLRTTRSRREVSEDSTISVSTHWRGKCFKSDETPSVAGGEEGKKTTQPC
GeneID:
150678
Stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Presentation
Purification:
Affinity purified
Buffer:
Phospate buffered saline, pH 7.2, containing 40% glycerol
Format:
Aff - Purified
ID Gène 150678

Accessory Products

  • LinkedIn