discontinued

NBP1-94030 MAP7D3 anticorps

See related secondary antibodies

Search for all "MAP7D3"

Vue générale rapide

Rabbit anti Human MAP7D3

NBP1-94030

Plus de vues

  • NBP1-94030

Description du Produit MAP7D3

Rabbit anti Human MAP7D3.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections.

Caractéristiques du Produit MAP7D3

Type de Produit Anticorps Primaires
Quantité 0.1 ml
Presentation Aff - Purified
Reactivité d'Espèce Hu
Applications ICC/IF, P
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Not USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q8IWC1
Immunogène:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EADNEESDKDSLNEMFPSAILNGTGSPTKFKMPFNNAKKMTHKLVFLEDGTSQVRKEPKTYFNGDLKNFRQKSMKDTSIQEVVSRPSSKRMTSH
GeneID:
79649
Stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Presentation
Purification:
Affinity purified
Buffer:
Phospate buffered saline, pH 7.2, containing 40% glycerol
Format:
Aff - Purified
ID Gène 79649

Accessory Products

Protéines et/ou Positive Controls

Positive Controls pour MAP7D3 (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

MAP7D3 overexpression lysate

MAP7D3 overexpression lysate
0.1 mg / 495,00 €
  OriGene Technologies, Inc.
  • LinkedIn