discontinued

H00054551-B01P MAGEL2 anticorps

See related secondary antibodies

Search for all "MAGEL2"

Vue générale rapide

Mouse anti Human MAGEL2

H00054551-B01P

Description du Produit MAGEL2

Mouse anti Human MAGEL2.
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit MAGEL2

Type de Produit Anticorps Primaires
Quantité 0.5 mg
Synonymes NDNL1, nM15
Reactivité d'Espèce Hu
Applications WB
Clonalité Polyclonal
Hôte Mouse
Destination Worldwide
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q6P3U4
Immunogène:
MAGEL2 (AAI67825.1, 1 a.a. ~ 646 a.a) full-length human protein.
Séquence AA:
MEFQEVQQTQALAWQAQKAPTHIWQPLPAQEAQRQAPPLVQLEQPFQGAPPSQKAVQIQLPPQQAQASGPQAEVPT LPLQPSWQAPPAVLQAQPGPPVAAANFPLGSAKSLMTPSGECRASSIDRRGSSKERRTSSKERRAPSKDRMIFAAT FCAPKAVSAARAHLPAAWKNLPATPETFAPSSSVFPATSQFQPASLNAFKGPSAASETPKSLPYALQDPFACVEAL PAVPWVPQPNMNASKASQAVPTFLMATAAAPQATATTQEASKTSVEPPRRSGKATRKKKHLEAQEDSRGHTLAFHD WQGPRPWENLNLSDWEVQSPIQVSGDWEHPNTPRGLSGWEGPSTSRILSGWEGPSASWALSAWEGPSTSRALGLSE SPGSSLPVVVSEVASVSPGSSATQDNSKVEAQPLSPLDERANALVQFLLVKDQAKVPVQRSEMVKVILREYKDECL DIINRANNKLECAFGYQLKEIDTKNHAYIIINKLGYHTGNLVASYLDRPKFGLLMVVLSLIFMKGNCVREDLIFNF LFKLGLDVRETNGLFGNTKKLITEVFVRQKYLEYRRIPYTEPAEYEFLWGPRAFLETSKMLVLRFLAKLHKKDPQS WPFHYLEALAECEWEDTDEDEPDTGDSAHGPTSRPPPR
GeneID:
54551
Add. information Mouse polyclonal antibody raised against a full-length human MAGEL2 protein.
Stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Presentation
Buffer:
In 1x PBS, pH 7.2
Specificité
Specificité:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn