discontinued

H00125336-B01P LOXHD1 anticorps

See related secondary antibodies

Search for all "LOXHD1"

Vue générale rapide

Mouse anti Human LOXHD1

H00125336-B01P

Description du Produit LOXHD1

Mouse anti Human LOXHD1.
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit LOXHD1

Type de Produit Anticorps Primaires
Quantité 0.5 mg
Synonymes FLJ32670, LH2D1
Reactivité d'Espèce Hu
Applications WB
Clonalité Polyclonal
Hôte Mouse
Destination Worldwide
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q8IVV2
Immunogène:
LOXHD1 (AAH47720.1, 1 a.a. ~ 512 a.a) full-length human protein.
Séquence AA:
MTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFL ERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGEN GDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWL SKSEGDGQTVRDFACANNKICDELEETTYEIVIETGNGGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTD TFEFDSIYLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTT ESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELR KVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLFPSV
GeneID:
125336
Add. information Mouse polyclonal antibody raised against a full-length human LOXHD1 protein.
Stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Presentation
Buffer:
In 1x PBS, pH 7.2
Specificité
Specificité:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn