discontinued

H00440332-M01 LOC440332 anticorps

See related secondary antibodies

Search for all "LOC440332"

Vue générale rapide

Mouse anti Human LOC440332 1G3

H00440332-M01

Description du Produit LOC440332

Mouse anti Human LOC440332 1G3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit LOC440332

Type de Produit Anticorps Primaires
Quantité 0.1 mg
Presentation Purified
Reactivité d'Espèce Hu
Applications WB
Clonalité Monoclonal
Clone 1G3
Hôte Mouse
Isotype IgG
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Immunogène:
LOC440332 (XP_496112, 253 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Séquence AA:
PPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTP PKLTAYLPAMSEDDEDCYGN*
Remarques:
Gene Accession: XM_496112
Stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Presentation
Buffer:
In 1x PBS, pH 7.2
Format:
Purified

Accessory Products

  • LinkedIn