discontinued

H00391749-B01P LOC391749 anticorps

See related secondary antibodies

Search for all "LOC391749"

Vue générale rapide

Mouse anti Human LOC391749

Description du Produit LOC391749

Mouse anti Human LOC391749.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Caractéristiques du Produit LOC391749

Type de Produit Anticorps Primaires
Quantité 50 µg
Synonymes -, TAFII, TAFII-28, TAFII28, TFIID subunit p30-beta, Transcription initiation factor TFIID 28 kDa subunit, similar to Transcription initiation factor TFIID subunit 11
Presentation Purified
Reactivité d'Espèce Hu
Applications E(detection), WB
Clonalité Polyclonal
Hôte Mouse
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Immunogène:
LOC391749 (XP_373061.2, 1 a.a. ~ 198 a.a) full-length human protein.
Séquence AA:
METGRQTGVSAEMLAMPRGLKGSKKDGIPEDLDGNLEAPRDQEGELRSEDVMDLTEGDSEASASAPPAAKRRKTHT KGKKESKPTVDAEEAHRMTTLLSAMSEEQLSRYEVCRRSAFPRARVAGLMRAITGSSVSENAAIAMAGIAKLFVGE VVEEALDVCEMWGETHPLQPKHLREAVRRLKPKGLFPNSNCRRIMF
Remarques:
Gene Accession: XM_373061.2
Add. information Mouse polyclonal antibody raised against a full-length human LOC391749 protein.

Antibody reactive against mammalian transfected lysate.
Applications Det Ab,WB-Tr
Stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Presentation
Buffer:
In 1x PBS, pH 7.2
Pureté:
Antibody reactive against mammalian transfected lysate.
Format:
Purified
Specificité
Espèces:
Human

Accessory Products

  • LinkedIn