discontinued

H00197350-B01P LOC197350 anticorps

See related secondary antibodies

Search for all "LOC197350"

Vue générale rapide

Mouse anti Human LOC197350

H00197350-B01P

Description du Produit LOC197350

Mouse anti Human LOC197350.
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit LOC197350

Type de Produit Anticorps Primaires
Quantité 0.5 mg
Synonymes -
Reactivité d'Espèce Hu
Applications WB
Clonalité Polyclonal
Hôte Mouse
Destination Worldwide
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
P0CB46
Immunogène:
LOC197350 (XP_945121.1, 1 a.a. ~ 183 a.a) full-length human protein.
Séquence AA:
MAHGGPRGQLLGADGQEVQPEALMQELSRCQVLQGRPKIFLLQACRGGNRDAGVGPTALPWYWSWLRAPPSVPSHA DVLQIYAEAQGSSCRGTPPGSSDQADILTVYSAAEGYVAYRDDKGSDFIQTLVEVLRANPGRDLLELLTEVNRRVC EQEVLGPDCDELRKACLEIRSSLRRRLCLQA
GeneID:
197350
Add. information Mouse polyclonal antibody raised against a full-length human LOC197350 protein.
Stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Presentation
Buffer:
In 1x PBS, pH 7.2
Specificité
Specificité:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn