TA331210 Lipase member N / LIPN anticorps

Rabbit Polyclonal Anti-LIPN Antibody

See related secondary antibodies

Search for all "Lipase member N / LIPN"

50 µg / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Vue générale rapide

Rabbit anti Human Lipase member N / LIPN

Description du Produit Lipase member N / LIPN

Rabbit anti Human Lipase member N / LIPN.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit Lipase member N / LIPN

Type de Produit Anticorps Primaires
Target Category
Quantité 50 µg
Synonymes LIPL4, Lipase-like abhydrolase domain-containing protein 4
Presentation Purified
Reactivité d'Espèce Hu
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur OriGene Technologies, Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q5VXI9
Immunogène:
The immunogen for Anti-LIPN antibody is: synthetic peptide directed towards the C-terminal region of Human LIPN. Synthetic peptide located within the following region: IFTRFFLLPNSIIKAVFGTKGFFLEDKKTKIASTKICNNKILWLICSEFM.
GeneID:
643418
Applications WB
Sujet The gene encodes a lipase that is highly expressed in granular keratinocytes in the epidermis, and plays a role in the differentiation of keratinocytes. Mutations in this gene are associated with lamellar ichthyosis type 4.
Presentation
Buffer:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Format:
Purified

Accessory Products

Protéines et/ou Positive Controls

Positive Controls pour Lipase member N / LIPN (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

LIPN overexpression lysate

LIPN overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn