discontinued

H00025896-B01 INTS7 anticorps

See related secondary antibodies

Search for all "INTS7"

Vue générale rapide

Mouse anti Human INTS7

H00025896-B01

Plus de vues

  • H00025896-B01

Description du Produit INTS7

Mouse anti Human INTS7.
Presentation: Serum
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Caractéristiques du Produit INTS7

Type de Produit Anticorps Primaires
Target Category
Quantité 50 µl
Synonymes C1orf73, INT7, Integrator complex subunit 7
Presentation Serum
Reactivité d'Espèce Hu
Applications E(detection), ICC/IF, WB
Clonalité Polyclonal
Hôte Mouse
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q9NVH2
Immunogène:
C1orf73 (NP_056249.1, 1 a.a. ~ 962 a.a) full-length human protein.
Séquence AA:
MASNSTKSFLADAGYGEQELDANSALMELDKGLRSGKLGEQCEAVVRFPRLFQKYPFPILINSAFLKLADVFRVGN NFLRLCVLKVTQQSEKHLEKILNVDEFVKRIFSVIHSNDPVARAITLRMLGSLASIIPERKNAHHSIRQSLDSHDN VEVEAAVFAAANFSAQSKDFAVGICNKISEMIQGLATPVDLKLKLIPILQHMHHDAILASSARQLLQQLVTSYPST KMVIVSLHTFTLLAASSLVDTPKQIQLLLQYLKNDPRKAVKRLAIQDLKLLANKTPHTWSRENIQALCECALQTPY DSLKLGMLSVLSTLSGTIAIKHYFSIVPGNVSSSPRSSDLVKLAQECCYHNNRGIAAHGVRVLTNITVSCQEKDLL ALEQDAVFGLESLLVLCSQDDSPGAQATLKIALNCMVKLAKGRPHLSQSVVETLLTQLHSAQDAARILMCHCLAAI AMQLPVLGDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQ ASRMGNHDMAKELYQSLLTQVASEHFYFWLNSLKEFSHAEQCLTGLQEENYSSALSCIAESLKFYHKGIASLTAAS TPLNPLSFQCEFVKLRIDLLQAFSQLICTCNSLKTSPPPAIATTIAMTLGNDLQRCGRISNQMKQSMEEFRSLASR YGDLYQASFDADSATLRNVELQQQSCLLISHAIEALILDPESASFQEYGSTGTAHADSEYERRMMSVYNHVLEEVE SLNRKYTPVSYMHTACLCNAIIALLKVPLSFQRYFFQKLQSTSIKLALSPSPRNPAEPIAVQNNQQLALKVEGVVQ HGSKPGLFRKIQSVCLNVSSTLQSKSGQDYKIPIDNMTNEMEQRVEPHNDYFSTQFLLNFAILGTHNITVESSVKD ANGIVWKTGPRTTIFVKSLEDPYSQQIRLQQQQAQQPLQQQQQRNAYTRF
GeneID:
25896
Remarques:
Gene Accession: NM_015434.1
Add. information Mouse polyclonal antibody raised against a full-length human C1orf73 protein.

Antibody reactive against mammalian transfected lysate.
Applications Det Ab,IF,WB-Tr
Stockage No additive
Presentation
Conjugation:
None
Purification:
Serum
Buffer:
No additive
Pureté:
Serum
Format:
Serum
Specificité
Espèces:
Human
ID Gène 25896

Accessory Products

Protéines et/ou Positive Controls

Protéines pour INTS7 (2 produits)

N° du Produit Espèces Presentation Pureté   Source  

INTS7

INTS7 Human Purified
  Abnova Taiwan Corp.

INTS7

INTS7 Human Purified
  Abnova Taiwan Corp.

Positive Controls pour INTS7 (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

INTS7 293T Cell Transient Overexpression Lysate(Denatured)

INTS7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn