TA342268 HOXB7 / HOX2C anticorps

Rabbit Polyclonal Anti-Hoxb7 Antibody

See related secondary antibodies

Search for all "HOXB7 / HOX2C"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Vue générale rapide

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat HOXB7 / HOX2C

Description du Produit HOXB7 / HOX2C

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat HOXB7 / HOX2C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit HOXB7 / HOX2C

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 ml
Synonymes HHO.C1, Homeobox protein Hox-B7, Hox-2C
Presentation Purified
Reactivité d'Espèce Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur OriGene Technologies, Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
P09629
Immunogène:
The immunogen for anti-Hoxb7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PGDPAKAAGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTL.
GeneID:
3217
Applications WB
Sujet Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positiol identities on the anterior-posterior axis.
Presentation
Buffer:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 15% sucrose.
Format:
Purified

Accessory Products

Protéines et/ou Positive Controls

Protéines pour HOXB7 / HOX2C (3 produits)

N° du Produit Espèces Presentation Pureté   Source  

HOXB7 / HOX2C

HOXB7 / HOX2C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

HOXB7 / HOX2C

HOXB7 / HOX2C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HOXB7 / HOX2C

HOXB7 / HOX2C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive Controls pour HOXB7 / HOX2C (3 produits)

N° du Produit Espèces Presentation Pureté   Source  

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-HOXB7 antibody (H00003217-M01) by Western Blots.
  Abnova Taiwan Corp.

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-HOXB7 antibody (H00003217-M02) by Western Blots.
  Abnova Taiwan Corp.

HOXB7 overexpression lysate

HOXB7 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn