TA335851 HOXB1 / HOX2I anticorps

Rabbit Polyclonal Anti-HOXB1 Antibody

See related secondary antibodies

Search for all "HOXB1 / HOX2I"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Vue générale rapide

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat HOXB1 / HOX2I

Description du Produit HOXB1 / HOX2I

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat HOXB1 / HOX2I.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit HOXB1 / HOX2I

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 ml
Synonymes Homeobox protein Hox-B1, Hox-2I
Presentation Purified
Reactivité d'Espèce Can, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur OriGene Technologies, Inc.

Extrait de la Fiche Technique

Swiss Prot:
The immunogen for Anti-HOXB1 Antibody: synthetic peptide directed towards the C terminal of human HOXB1. Synthetic peptide located within the following region: FQNRRMKQKKREREEGRVPPAPPGCPKEAAGDASDQSTCTSPEASPSSVT.
Applications WB
Sujet This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.
Affinity Purified
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Protéines et/ou Positive Controls

Protéines pour HOXB1 / HOX2I (9 produits)

N° du Produit Espèces Presentation Pureté   Source  


HOXB1 / HOX2I Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.


HOXB1 / HOX2I Human
  Abnova Taiwan Corp.


HOXB1 / HOX2I Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


HOXB1 / HOX2I Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


HOXB1 / HOX2I Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


HOXB1 / HOX2I Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


HOXB1 / HOX2I Human Purified
  Abnova Taiwan Corp.


HOXB1 / HOX2I Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


HOXB1 / HOX2I Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive Controls pour HOXB1 / HOX2I (2 produits)

N° du Produit Espèces Presentation Pureté   Source  

HOXB1 293T Cell Transient Overexpression Lysate(Denatured)

HOXB1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HOXB1 overexpression lysate

HOXB1 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn