NBP1-57033 Glycerol kinase anticorps

See related secondary antibodies

Search for all "Glycerol kinase"

Vue générale rapide

Rabbit anti Human Glycerol kinase


Description du Produit Glycerol kinase

Rabbit anti Human Glycerol kinase.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit Glycerol kinase

Type de Produit Anticorps Primaires
Quantité 50 µg
Synonymes GK1, GKD
Presentation Aff - Purified
Reactivité d'Espèce Hu
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Destination Europe only
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Swiss Prot:
Synthetic peptides corresponding to GK (glycerol kinase) The peptide sequence was selected from the middle region of GK. Peptide sequence MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS.
Sujet The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been identified.
Stockage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
ID Gène 2710

Accessory Products

  • LinkedIn