discontinued

H00080772-B01P GLTPD1 anticorps

See related secondary antibodies

Search for all "GLTPD1"

Vue générale rapide

Mouse anti Human GLTPD1

H00080772-B01P

Description du Produit GLTPD1

Mouse anti Human GLTPD1.
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit GLTPD1

Type de Produit Anticorps Primaires
Quantité 0.5 mg
Synonymes MGC10334
Reactivité d'Espèce Hu
Applications WB
Clonalité Polyclonal
Hôte Mouse
Destination Worldwide
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q5TA50
Immunogène:
GLTPD1 (AAH04366.1, 1 a.a. ~ 221 a.a) full-length human protein.
Séquence AA:
MCPHLRPVPGTPCLPRWAALSPGDSVPSMPWLAETLNSSLGTVGLSPPLLPCLPLSVPGRLGAGQPEAETKAPHRR AQEVPALGTASSVAPARHQFPEGRSRPPPAAAVGLHSPAQPKAPRSWDSATPSEMLCPFSPVPLDAPSPQCSGDPW GTEQEGLDPVAQPKATRQPQPAQPPSSAWGLATGSSQWTPAPRGGRGTAPTAQQTCELPECNLCDVFQR
GeneID:
80772
Add. information Mouse polyclonal antibody raised against a full-length human GLTPD1 protein.
Stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Presentation
Buffer:
In 1x PBS, pH 7.2
Specificité
Specificité:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Protéines et/ou Positive Controls

Protéines pour GLTPD1 (2 produits)

N° du Produit Espèces Presentation Pureté   Source  

GLTPD1 (1-214, His-tag)

GLTPD1 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / 730,00 €
  OriGene Technologies GmbH

GLTPD1 (1-214, His-tag)

GLTPD1 Human Purified > 90 % by SDS - PAGE E. coli
20 µg / 300,00 €
  OriGene Technologies GmbH
  • LinkedIn