TA337310 FGD5 anticorps

Rabbit Polyclonal Anti-FGD5 Antibody

See related secondary antibodies

Search for all "FGD5"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Vue générale rapide

Rabbit anti Canine, Equine, Human, Mouse, Rat FGD5

Description du Produit FGD5

Rabbit anti Canine, Equine, Human, Mouse, Rat FGD5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit FGD5

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 ml
Synonymes FYVE, RhoGEF and PH domain-containing protein 5, ZFYVE23, Zinc finger FYVE domain-containing protein 23
Presentation Purified
Reactivité d'Espèce Can, Eq, Hu, Ms, Rt
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur OriGene Technologies, Inc.

Extrait de la Fiche Technique

Swiss Prot:
The immunogen for Anti-FGD5 antibody is: synthetic peptide directed towards the C-terminal region of Human FGD5. Synthetic peptide located within the following region: FVIKGKVLYTYMASEDKVALESMPLLGFTIAPEKEEGSSEVGPIFHLYHK.
Applications WB
Sujet FGD5 activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. It mediates VEGF-induced CDC42 activation. It may regulate proangiogenic action of VEGF in vascular endothelial cells, including network formation, directiol movement and proliferation and may play a role in regulating the actin cytoskeleton and cell shape.
Affinity Purified
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Protéines et/ou Positive Controls

Protéines pour FGD5 (2 produits)

N° du Produit Espèces Presentation Pureté   Source  


FGD5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


FGD5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive Controls pour FGD5 (2 produits)

N° du Produit Espèces Presentation Pureté   Source  

FGD5 293T Cell Transient Overexpression Lysate(Denatured)

FGD5 293T Cell Transient Overexpression Lysate(Denatured) Transient overexpression cell lysate was tested with Anti-FGD5 antibody (H00152273-B01) by Western Blots.
  Abnova Taiwan Corp.

FGD5 overexpression lysate

FGD5 overexpression lysate
0.1 mg / 495,00 €
  OriGene Technologies, Inc.
  • LinkedIn