discontinued

H00091828-B01P EXOC3L4 anticorps

See related secondary antibodies

Search for all "EXOC3L4"

Vue générale rapide

Mouse anti Human EXOC3L4

H00091828-B01P

Description du Produit EXOC3L4

Mouse anti Human EXOC3L4.
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit EXOC3L4

Type de Produit Anticorps Primaires
Quantité 0.5 mg
Synonymes -
Reactivité d'Espèce Hu
Applications WB
Clonalité Polyclonal
Hôte Mouse
Destination Worldwide
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q17RC7
Immunogène:
EXOC3L4 (ADR83343.1, 1 a.a. ~ 722 a.a) full-length human protein.
Séquence AA:
MPSPQTDTPGPELQSPKEAEEPQTPAQGSRRTSSRKEPNAHRKDGTRLGLGSLRQAFSRASQRALTQVSKEDTGLF RRSSCSLFRSFRQALNDGPATGHSQATPEVPSGVMNGVSQQASTGAASEELKPEAEGKSVADLITERQLLAAFEQL LRLETLLVAEKASRTFEQDPTAFARRAMDVCLLYDGLAAEIGAIVRETLDSDGVDAAALAELARVVSAEEEAHPSP PDDGDFLRTPRRWRQHWEEAVRRSAQERVRRPGAGWAFGEAEGASGLAQLLAELGGLVRRDLQKVRQEVQPAYAAA GFPAWEVYLRAFHSAVAQRLQELARDARGCEQLYILLDWAANVYGSPDFLGAPGLALPAEPLPPLLAPDVWARLES DYTSFLEAKIASCFDSILQLEQSHWAAAEVPEVLQGLYQAPLSMDVHMLVAEHVKAAGAISAELEATTLRICTRAL GLFVPRFEKAFLASEAVSEPHLGAYINACEELRTSLLSRFPGTQEELEKPLVTATCSFQKHLLQGLQRELQPLFRV VCTRDWLTQDWLHPLMDKVVTFAGHLQRVARPRAQETLQEVHRFVVREYLARALRPRERFRGMERMHGSQKMSLDA QAISDTFQGLGSEATWLDQAIQCVAEILGETYKDDIQRHLETLIRSYPDIRRDHILAILALRRLGRRRNQHLLQHT EDLLRAAAGAAGAEAPRGRVLFEEIKVPSAMAVLITCV
GeneID:
91828
Add. information Mouse polyclonal antibody raised against a full-length human EXOC3L4 protein.
Stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Presentation
Buffer:
In 1x PBS, pH 7.2
Specificité
Specificité:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Protéines et/ou Positive Controls

Positive Controls pour EXOC3L4 (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

EXOC3L4 overexpression lysate

EXOC3L4 overexpression lysate
0.1 mg / 495,00 €
  OriGene Technologies, Inc.
  • LinkedIn