discontinued

H00002035-D01P EPB41 / Protein 4.1 anticorps

See related secondary antibodies

Search for all "EPB41 / Protein 4.1"

Vue générale rapide

Rabbit anti Human EPB41 / Protein 4.1

Description du Produit EPB41 / Protein 4.1

Rabbit anti Human EPB41 / Protein 4.1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Caractéristiques du Produit EPB41 / Protein 4.1

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 mg
Synonymes 4.1R, Band 4.1, E41P, EPB4.1, P4.1
Presentation Purified
Reactivité d'Espèce Hu
Applications E(detection), WB
Clonalité Polyclonal
Hôte Rabbit
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
P11171
Immunogène:
EPB41 (AAH39079.1, 1 a.a. ~ 720 a.a) full-length human protein.
Séquence AA:
MTTEKSLVTEAENSQHQQKEEGEEAINSGQQEPQQEESCQTAAEGDNWCEQKLKASNGDTPTHEDLTKNKERTSES RGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSS AETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECVVEK HAKGQDLLKRVCEHLNLLEEDYFGLAIWDNATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDITRYY LCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMTPA QADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQ EQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTIPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFE RTASKRASRSLDGAAAVDSADRSPRPTSAPAITQGQVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEP EPTEAWKVEKTHIEVTVPTSNGDQTQKKRERLDGENIYIRHSNLMLEDLDKSQEEIKKHHASISELKKNFMESVPE PRPSEWDKRLSTHSPFRTLNINGQIPTGEGVSTLST
GeneID:
2035
Remarques:
Gene Accession: BC039079.1
Add. information Rabbit polyclonal antibody raised against a full-length human EPB41 protein.

Antibody reactive against mammalian transfected lysate.
Applications Det Ab,WB-Tr
Stockage In 1x PBS, pH 7.2
Presentation
Conjugation:
None
Purification:
Purified
Buffer:
In 1x PBS, pH 7.2
Pureté:
Purified
Format:
Purified
Specificité
Espèces:
Human
ID Gène 2035

Accessory Products

Protéines et/ou Positive Controls

Protéines pour EPB41 / Protein 4.1 (6 produits)

N° du Produit Espèces Presentation Pureté   Source  

EPB41 / Protein 4.1 (transcript variant 2)

EPB41 / Protein 4.1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

EPB41 / Protein 4.1

EPB41 / Protein 4.1 Human Purified
  Abnova Taiwan Corp.

EPB41 / Protein 4.1

EPB41 / Protein 4.1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EPB41 / Protein 4.1

EPB41 / Protein 4.1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EPB41 / Protein 4.1

EPB41 / Protein 4.1 Human
  Abnova Taiwan Corp.

EPB41 / Protein 4.1

EPB41 / Protein 4.1 Human
  Abnova Taiwan Corp.

Positive Controls pour EPB41 / Protein 4.1 (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

EPB41 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

EPB41 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-EPB41 antibody (H00002035-M01) by Western Blots.
  Abnova Taiwan Corp.
  • LinkedIn