TA346196 Eosinophil peroxidase anticorps

Rabbit Polyclonal Anti-EPX Antibody

See related secondary antibodies

Search for all "Eosinophil peroxidase"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Vue générale rapide

Rabbit anti Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Eosinophil peroxidase

TA346196

Plus de vues

  • TA346196

Description du Produit Eosinophil peroxidase

Rabbit anti Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Eosinophil peroxidase.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit Eosinophil peroxidase

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 ml
Synonymes EPER, EPO, EPP, EPX
Presentation Purified
Reactivité d'Espèce Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur OriGene Technologies, Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
P11678
Immunogène:
The immunogen for anti-EPX antibody: synthetic peptide directed towards the middle region of human EPX. Synthetic peptide located within the following region: LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDP.
GeneID:
8288
Applications WB
Sujet EPX belongs to the peroxidase family, XPO subfamily. Defects in EPX are the cause of eosinophil peroxidase deficiency (EPD).
Presentation
Purification:
Affinity Purified
Buffer:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Format:
Purified

Accessory Products

Protéines et/ou Positive Controls

Protéines pour Eosinophil peroxidase (3 produits)

N° du Produit Espèces Presentation Pureté   Source  

Eosinophil peroxidase

Eosinophil peroxidase Human Purified >95% pure by SDS-PAGE. Eosinophils
0.2 mg / 1 220,00 €
  OriGene Technologies GmbH

Eosinophil peroxidase

Eosinophil peroxidase Human Purified
  Abnova Taiwan Corp.

Eosinophil peroxidase

Eosinophil peroxidase Human Purified
  Abnova Taiwan Corp.

Positive Controls pour Eosinophil peroxidase (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

EPX Lysate

Western Blot: EPX Lysate [NBL1-10306] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for EPX
  Novus Biologicals Inc.
  • LinkedIn