discontinued

H00002005-B01P ELK4 anticorps

See related secondary antibodies

Search for all "ELK4"

Vue générale rapide

Mouse anti Human ELK4

H00002005-B01P

Plus de vues

  • H00002005-B01P
  • H00002005-B01P

Description du Produit ELK4

Mouse anti Human ELK4.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Caractéristiques du Produit ELK4

Type de Produit Anticorps Primaires
Target Category
Quantité 50 µg
Synonymes ETS domain-containing protein Elk-4, SAP1, SRF accessory protein 1, Serum response factor accessory protein 1
Presentation Purified
Reactivité d'Espèce Hu
Applications E(detection), ICC/IF, WB
Clonalité Polyclonal
Hôte Mouse
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
P28324
Immunogène:
ELK4 (NP_068567.1, 1 a.a. ~ 405 a.a) full-length human protein.
Séquence AA:
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVN GQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTL NSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQALETL VSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEPKDQD SVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQVACSLFMVSPLLSFICPFKQ IQNLYTQVCFLLLRFVLERLCVTVM
GeneID:
2005
Remarques:
Gene Accession: NM_021795.2
Add. information Mouse polyclonal antibody raised against a full-length human ELK4 protein.

Antibody reactive against mammalian transfected lysate.
Applications Det Ab,IF,WB-Ti,WB-Tr
Stockage In 1x PBS, pH 7.2
Presentation
Conjugation:
None
Purification:
Purified
Buffer:
In 1x PBS, pH 7.2
Pureté:
Purified
Format:
Purified
Specificité
Espèces:
Human
ID Gène 2005

Accessory Products

Protéines et/ou Positive Controls

Protéines pour ELK4 (6 produits)

N° du Produit Espèces Presentation Pureté   Source  

ELK4 (transcript variant b)

ELK4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

ELK4 (full length, N-term HIS tag, transcript variant a)

ELK4 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / 199,00 €
  OriGene Technologies, Inc.

ELK4

ELK4 Human Purified
  Abnova Taiwan Corp.

ELK4

ELK4 Human Purified
  Abnova Taiwan Corp.

ELK4

ELK4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ELK4

ELK4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive Controls pour ELK4 (3 produits)

N° du Produit Espèces Presentation Pureté   Source  

ELK4 293T Cell Transient Overexpression Lysate(Denatured)

ELK4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ELK4 Lysate

Western Blot: ELK4 Lysate [NBL1-10234] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ELK4
  Novus Biologicals Inc.

ELK4 Lysate

Western Blot: ELK4 Lysate [NBL1-10235] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ELK4
  Novus Biologicals Inc.
  • LinkedIn