discontinued

NBP1-80999 EGR4 anticorps

See related secondary antibodies

Search for all "EGR4"

Vue générale rapide

Rabbit anti Human EGR4

NBP1-80999

Plus de vues

  • NBP1-80999

Description du Produit EGR4

Rabbit anti Human EGR4.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Caractéristiques du Produit EGR4

Type de Produit Anticorps Primaires
Quantité 0.1 ml
Presentation Aff - Purified
Reactivité d'Espèce Hu
Applications P, WB
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Not USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q9UDE5
Immunogène:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSISCPAELPAVPANRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSSGDGGEFLASTQPQLSPLGLRSAAAADFPKPL
Stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Presentation
Purification:
Affinity purified
Buffer:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
Format:
Aff - Purified

Accessory Products

  • LinkedIn