discontinued

H00008562-D01P DENR / DRP1 anticorps

See related secondary antibodies

Search for all "DENR / DRP1"

Vue générale rapide

Rabbit anti Human DENR / DRP1

Description du Produit DENR / DRP1

Rabbit anti Human DENR / DRP1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Caractéristiques du Produit DENR / DRP1

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 mg
Synonymes DRP, Density-regulated protein, H14, SMAP-3, Smooth muscle cell-associated protein 3
Presentation Purified
Reactivité d'Espèce Hu
Applications E(detection), WB
Clonalité Polyclonal
Hôte Rabbit
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
O43583
Immunogène:
DENR (NP_003668.2, 1 a.a. ~ 198 a.a) full-length human protein.
Séquence AA:
MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQ EAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKF SCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK
GeneID:
8562
Remarques:
Gene Accession: NM_003677.3
Add. information Rabbit polyclonal antibody raised against a full-length human DENR protein.

Antibody reactive against mammalian transfected lysate.
Applications Det Ab,WB-Tr
Stockage In 1x PBS, pH 7.2
Presentation
Conjugation:
None
Purification:
Purified
Buffer:
In 1x PBS, pH 7.2
Pureté:
Purified
Format:
Purified
Specificité
Espèces:
Human
ID Gène 8562

Accessory Products

Protéines et/ou Positive Controls

Protéines pour DENR / DRP1 (7 produits)

N° du Produit Espèces Presentation Pureté   Source  

DENR / DRP1

DENR / DRP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

DENR / DRP1 (1-198, His-tag)

DENR / DRP1 Human Purified > 85 % E. coli
0.5 mg / 750,00 €
  Acris Antibodies GmbH

DENR / DRP1 (1-198, His-tag)

DENR / DRP1 Human Purified > 85 % E. coli
0.1 mg / 300,00 €
  Acris Antibodies GmbH

DENR / DRP1

DENR / DRP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DENR / DRP1

DENR / DRP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DENR / DRP1

DENR / DRP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DENR / DRP1

DENR / DRP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive Controls pour DENR / DRP1 (2 produits)

N° du Produit Espèces Presentation Pureté   Source  

DENR 293T Cell Transient Overexpression Lysate(Denatured)

DENR 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DENR Lysate

Western Blot: DENR Lysate [NBL1-09832] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DENR
  Novus Biologicals Inc.
  • LinkedIn