discontinued

NBP1-53187 Cytokeratin 7 anticorps

See related secondary antibodies

Search for all "Cytokeratin 7"

Vue générale rapide

Rabbit anti Human Cytokeratin 7

Description du Produit Cytokeratin 7

Rabbit anti Human Cytokeratin 7.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit Cytokeratin 7

Type de Produit Anticorps Primaires
Quantité 50 µg
Synonymes CK7, K2C7, K7, MGC129731, MGC3625, SCL
Presentation Aff - Purified
Reactivité d'Espèce Hu
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Destination Europe only
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
A5A6N0
Immunogène:
Synthetic peptides corresponding to KRT7(keratin 7) The peptide sequence was selected from the N terminal of KRT7. Peptide sequence SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV.
GeneID:
466983
Sujet KRT7 is a member of the keratin protein family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Stockage Store at -20C. Avoid freeze-thaw cycles.
Presentation
Purification:
Peptide affinity purified
Buffer:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Format:
Aff - Purified
ID Gène 466983

Accessory Products

  • LinkedIn