discontinued

H00008454-D01P Cullin 1 anticorps

See related secondary antibodies

Search for all "Cullin 1"

Vue générale rapide

Rabbit anti Human Cullin 1

H00008454-D01P

Plus de vues

  • H00008454-D01P

Description du Produit Cullin 1

Rabbit anti Human Cullin 1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Caractéristiques du Produit Cullin 1

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 mg
Synonymes CUL-1, CUL1, Cullin-1
Presentation Purified
Reactivité d'Espèce Hu
Applications E(detection), WB
Clonalité Polyclonal
Hôte Rabbit
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q13616
Immunogène:
CUL1 (NP_003583.2, 1 a.a. ~ 776 a.a) full-length human protein.
Séquence AA:
MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQ TPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEG RKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVY KESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFH TEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNAL VMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYI EDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLD LDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQM AILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNI NVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKE YLERVDGEKDTYSYLA
GeneID:
8454
Remarques:
Gene Accession: NM_003592
Add. information Rabbit polyclonal antibody raised against a full-length human CUL1 protein.

Antibody reactive against mammalian transfected lysate.
Applications Det Ab,PLA-Ce,WB-Tr
Stockage In 1x PBS, pH 7.2
Presentation
Conjugation:
None
Purification:
Purified
Buffer:
In 1x PBS, pH 7.2
Pureté:
Purified
Format:
Purified
Specificité
Espèces:
Human
ID Gène 8454

Accessory Products

Protéines et/ou Positive Controls

Protéines pour Cullin 1 (7 produits)

N° du Produit Espèces Presentation Pureté   Source  

Cullin 1

Cullin 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

Cullin 1 (1-410, His-tag)

Recombinant human CUL1, 1- 410 aa, His-tagged Human Purified > 95 % E. coli
0.25 mg / 750,00 €
  OriGene Technologies GmbH

Cullin 1 (1-410, His-tag)

Recombinant human CUL1, 1- 410 aa, His-tagged Human Purified > 95 % E. coli
50 µg / 300,00 €
  OriGene Technologies GmbH

Cullin 1

Cullin 1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cullin 1

Cullin 1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cullin 1

Cullin 1 Human Purified
  Novus Biologicals Inc.

Cullin 1

Cullin 1 Human Purified
  Novus Biologicals Inc.

Positive Controls pour Cullin 1 (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

Cullin 1 Lysate

Western Blot: Cullin 1 Lysate [NBL1-09606] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CUL1
  Novus Biologicals Inc.
  • LinkedIn