discontinued

H00131544-B01P CRYBG3 anticorps

See related secondary antibodies

Search for all "CRYBG3"

Vue générale rapide

Mouse anti Human CRYBG3

H00131544-B01P

Description du Produit CRYBG3

Mouse anti Human CRYBG3.
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit CRYBG3

Type de Produit Anticorps Primaires
Quantité 0.5 mg
Synonymes DKFZp667G2110, DKFZp686L13211
Reactivité d'Espèce Hu
Applications WB
Clonalité Polyclonal
Hôte Mouse
Destination Worldwide
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q68DQ2
Immunogène:
CRYBG3 (AAI48427.1, 1 a.a. ~ 1022 a.a) full-length human protein.
Séquence AA:
MPDFQPGDTTVRLDKRMSLTAIYDKRRETDYSDKGYNLAFVSQDEQENSSFTILYEEPLQEEDKYASAEARQTQSV LFHDTSADSMPVLACERSESRTDLVHHFEKGTKLGETFDSDSSEMFLSVEAKRYKIYPLALSPIYEDDSSQEDILS SEVSPGHHGPRKSRDSENQSSSVLSLLQSVSERLKMNFDEDDREAADEEEEEEEAAVLHKGDLRAGSGERVTFQLP DPSITFYPDDQESVGISKNSYVMPNEPTTSNLQVGLWPEKTSFLQKSDLTSKLHSSLKSAYHQYLQTSQSHSSEKG ARFGGIFQEPVSKYFRVQDSPGRLSPFIENVDKQTLRCNPRPGKMVIYDLHESTYKQEVYCNIPDATSWSFPNGVL IKVVRGCWILYEKPHFRGQKCVLEEGEKVLNRDWILQNRRHPQRNFILGSLKRVLKDCSIPEIELFPQSDPACCPV YIQRAVPNLEELNISKSVSFTVKSGVWLAYPDINFKGQATVLEEDHGLFEISTAEMKSLHPLQMGGLKVEMPMNLK VIIYEKPHFHGQAKEFSEHIDSVPNFLKNNGDFHRIGSIRVIGGVWVAYEKEHFKGQQFLLEEGDFEDSNACGALS SPILSFRYLQANFIESSVTLFESDLESGKFIDITNQEISDLEEIGFGSKTRSIHVKSGVWVAYQQKFFCGEQYILE KGKYKCFFDWGGSNNIIMSIRPIQLEPLGINEPPHLLKAFSKPGFQGECIDFTEETSDLTSLMPCSFKVLRGCWLL YYQEDMFVNHCVLEEGLYADLTSCGCPASKVKSLKPIDYVFEEPSISLFALEHCEGRELHLEEAVNSVLNKDLHFY TQSVWVKSGLWIAYEGSNFLGRQILLRPNEIPNWTAFSRWKTIGSLRPMKQPAVYIRIKNRAQGEYLTVTGSLADT RATSVCISPYSGKNTQIWYYCRGLFKSKASDTCLDVIGGRDTPGAKVALWTEHGQFRQKWRLNKNGTISSYLSDQL VLDVKGGNYCDKTHVIVNQPLEGEETQKWDIEIL
GeneID:
131544
Add. information Mouse polyclonal antibody raised against a full-length human CRYBG3 protein.
Stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Presentation
Buffer:
In 1x PBS, pH 7.2
Specificité
Specificité:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn