TA342870 Complement factor D anticorps

Rabbit Polyclonal Anti-CFD Antibody

See related secondary antibodies

Search for all "Complement factor D"

50 µg / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Vue générale rapide

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat Complement factor D

Description du Produit Complement factor D

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat Complement factor D.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit Complement factor D

Type de Produit Anticorps Primaires
Target Category
Quantité 50 µg
Synonymes Adipsin, C3 convertase activator, CFD, DF, PFD, Properdin factor D
Presentation Purified
Reactivité d'Espèce Bov, Can, GP, Hu, Ms, Por, Rt
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur OriGene Technologies, Inc.

Extrait de la Fiche Technique

Swiss Prot:
The immunogen for anti-CFD antibody: synthetic peptide directed towards the C terminal of human CFD. Synthetic peptide located within the following region: GRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSG.
Applications WB
Sujet CFD is a member of the trypsin family of peptidases. The protein is a component of the altertive complement pathway best known for its role in humoral suppression of infectious agents. This protein is also a serine protease that is secreted by adipocytes into the bloodstream. Filly, this protein has a high level of expression in fat, suggesting a role for adipose tissue in immune system biology.
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 628% sucrose.

Accessory Products

Protéines et/ou Positive Controls

Protéines pour Complement factor D (12 produits)

N° du Produit Espèces Presentation Pureté   Source  

Complement factor D

Complement factor D Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

Complement factor D (26-253, His-tag)

Complement factor D Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / 730,00 €
  OriGene Technologies GmbH

Complement factor D (26-253, His-tag)

Complement factor D Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / 300,00 €
  OriGene Technologies GmbH

Complement factor D (21-253, His-tag)

Complement factor D Human Purified > 95 % by SDS - PAGE.
0.25 mg / 940,00 €
  OriGene Technologies GmbH

Complement factor D (21-253, His-tag)

Complement factor D Human Purified > 95 % by SDS - PAGE.
50 µg / 300,00 €
  OriGene Technologies GmbH

Complement factor D

Complement factor D Human
  Abnova Taiwan Corp.

Complement factor D

Complement factor D Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Complement factor D

Complement factor D Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Complement factor D

Complement factor D Human
  Abnova Taiwan Corp.

Complement factor D

Complement factor D Human
  Abnova Taiwan Corp.

Complement factor D (WB+ control)

Complement factor D Purified
  Alpha Diagnostic Intl. Inc.

Complement factor D

Complement factor D Human
  Alpha Diagnostic Intl. Inc.
  • LinkedIn