discontinued

H00001690-B01P Cochlin anticorps

See related secondary antibodies

Search for all "Cochlin"

Vue générale rapide

Mouse anti Human Cochlin

H00001690-B01P

Plus de vues

  • H00001690-B01P

Description du Produit Cochlin

Mouse anti Human Cochlin.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Caractéristiques du Produit Cochlin

Type de Produit Anticorps Primaires
Target Category
Quantité 50 µg
Synonymes COCH, COCH-5B2, COCH5B2
Presentation Purified
Reactivité d'Espèce Hu
Applications E(detection), WB
Clonalité Polyclonal
Hôte Mouse
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
O43405
Immunogène:
COCH (AAH07230.1, 1 a.a. ~ 494 a.a) full-length human protein.
Séquence AA:
MSAAWIPALGLGVCLLLLPGPAGSEGAAPIAITCFTRGLDIRKEKADVLCPGGCPLEEFSVYGNIVYASVSSICGA AVHRGVISNSGGPVRVYSLPGRENYSSVDANGIQSQMLSRWSASFTVTKGKSSTQEATGQAVSTAHPPTGKRLKKT PEKKTGNKDCKADIAFLIDGSFNIGQRRFNLQKNFVGKVALMLGIGTEGPHVGLVQASEHPKIEFYLKNFTSAKDV LFAIKEVGFRGGNSNTGKALKHTAQKFFTVDAGVRKGIPKVVVVFIDGWPSDDIEEAGIVAREFGVNVFIVSVAKP IPEELGMVQDVTFVDKAVCRNNGFFSYHMPNWFGTTKYVKPLVQKLCTHEQMMCSKTCYNSVNIAFLIDGSSSVGD SNFRLMLEFVSNIAKTFEISDIGAKIAAVQFTYDQRTEFSFTDYSTKENVLAVIRNIRYMSGGTATGDAISFTVRN VFGPIRESPNKNFLVIVTDGQSYDDVQGPAAAAHDAAK
GeneID:
1690
Remarques:
Gene Accession: BC007230
Add. information Mouse polyclonal antibody raised against a full-length human COCH protein.

Antibody reactive against mammalian transfected lysate.
Applications Det Ab,WB-Ce,WB-Tr
Stockage In 1x PBS, pH 7.2
Presentation
Conjugation:
None
Purification:
Purified
Buffer:
In 1x PBS, pH 7.2
Pureté:
Purified
Format:
Purified
Specificité
Espèces:
Human
ID Gène 1690

Accessory Products

Protéines et/ou Positive Controls

Protéines pour Cochlin (3 produits)

N° du Produit Espèces Presentation Pureté   Source  

Cochlin

Cochlin Human
  Abnova Taiwan Corp.

Cochlin

Cochlin Human Purified
  Abnova Taiwan Corp.

Cochlin

Cochlin Human Purified
  Abnova Taiwan Corp.

Positive Controls pour Cochlin (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

COCH 293T Cell Transient Overexpression Lysate(Denatured)

COCH 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn