
NBP1-94102 CLTCL1 anticorps

See related secondary antibodies

Search for all "CLTCL1"

Vue générale rapide

Rabbit anti Human CLTCL1

Description du Produit CLTCL1

Rabbit anti Human CLTCL1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Caractéristiques du Produit CLTCL1

Type de Produit Anticorps Primaires
Quantité 0.1 ml
Presentation Aff - Purified
Reactivité d'Espèce Hu
Applications P
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Not USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Swiss Prot:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KSVNEALNHLLTEEEDYQDAMQHAAESRDAELAQKLLQWFLEEGKRECFA
Stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Affinity purified
Phospate buffered saline, pH 7.2, containing 40% glycerol
Aff - Purified
ID Gène 8218

Accessory Products

Protéines et/ou Positive Controls

Protéines pour CLTCL1 (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

Clathrin, heavy chain-like 1 (CLTCL1)

Clathrin, heavy chain-like 1 (CLTCL1) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

Positive Controls pour CLTCL1 (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

CLTCL1 overexpression lysate

CLTCL1 overexpression lysate
0.1 mg / 495,00 €
  OriGene Technologies, Inc.
  • LinkedIn