discontinued

H00005818-D01 CD111 / Nectin 1 anticorps

See related secondary antibodies

Search for all "CD111 / Nectin 1"

Vue générale rapide

Rabbit anti Human CD111 / Nectin 1

Description du Produit CD111 / Nectin 1

Rabbit anti Human CD111 / Nectin 1.
Presentation: Serum
Product is tested for ELISA (detection), Immunoprecipitation.

Caractéristiques du Produit CD111 / Nectin 1

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 ml
Synonymes HVEC, Herpes virus entry mediator C, Herpesvirus Ig-like receptor, Nectin-1, PRR1, PVRL1, Poliovirus receptor-related protein 1
Presentation Serum
Reactivité d'Espèce Hu
Applications E(detection), IP
Clonalité Polyclonal
Hôte Rabbit
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q15223
Immunogène:
PVRL1 (NP_976031.1, 1 a.a. ~ 352 a.a) full-length human protein.
Séquence AA:
MARMGLAGAAGRWWGLALGLTAFFLPGVHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQ NVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEG TQAVLRAKKGQDDKVLVATCTSANGKPPSVVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACIV NYHMDRFKESLTLNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPATEYHWTTLNGSLPKGVEAQNRTLFFKG PINYSLAGTYICEATNPIGTRSGQVEVNITAFCQLIYPGKGRTRARMF
GeneID:
5818
Remarques:
Gene Accession: NM_203286.1
Add. information Rabbit polyclonal antibody raised against a full-length human PVRL1 protein.

Antibody reactive against mammalian transfected lysate.
Applications Det Ab,IP
Stockage No additive
Presentation
Conjugation:
None
Purification:
Serum
Buffer:
No additive
Pureté:
Serum
Format:
Serum
Specificité
Espèces:
Human
ID Gène 5818

Accessory Products

Protéines et/ou Positive Controls

Protéines pour CD111 / Nectin 1 (9 produits)

N° du Produit Espèces Presentation Pureté   Source  

CD111 / Nectin 1 (transcript variant 1)

CD111 / Nectin 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

CD111 / Nectin 1 (transcript variant 1)

CD111 / Nectin 1 E. coli > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / 299,00 €
  OriGene Technologies, Inc.

CD111 / Nectin 1

CD111 / Nectin 1 Human
  Abnova Taiwan Corp.

CD111 / Nectin 1

CD111 / Nectin 1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CD111 / Nectin 1

CD111 / Nectin 1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CD111 / Nectin 1

CD111 / Nectin 1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD111 / Nectin 1

CD111 / Nectin 1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD111 / Nectin 1

CD111 / Nectin 1 Human
  Abnova Taiwan Corp.

CD111 / Nectin 1

CD111 / Nectin 1 Human > 90 % Sf9-Baculovirus
  Virusys Corporation

Positive Controls pour CD111 / Nectin 1 (5 produits)

N° du Produit Espèces Presentation Pureté   Source  

PVRL1 293T Cell Transient Overexpression Lysate(Denatured)

PVRL1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PVRL1 Lysate

Western Blot: PVRL1 Lysate [NBL1-15005] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PVRL1
  Novus Biologicals Inc.

PVRL1 overexpression lysate

PVRL1 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.

PVRL1 overexpression lysate

PVRL1 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.

PVRL1 overexpression lysate

PVRL1 overexpression lysate
0.1 mg / 315,00 €
  OriGene Technologies, Inc.
  • LinkedIn