discontinued

H00009973-A01 CCS / SOD4 anticorps

See related secondary antibodies

Search for all "CCS / SOD4"

Vue générale rapide

Mouse anti Human CCS / SOD4

Description du Produit CCS / SOD4

Mouse anti Human CCS / SOD4.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Caractéristiques du Produit CCS / SOD4

Type de Produit Anticorps Primaires
Target Category
Quantité 50 µl
Synonymes SOD-4, Superoxide Dismutase Copper Chaperone
Presentation Serum
Reactivité d'Espèce Hu
Applications E, WB
Clonalité Polyclonal
Hôte Mouse
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
O14618
Immunogène:
CCS (NP_005116, 175 a.a. ~ 275 a.a) partial recombinant protein with GST tag.
Séquence AA:
ADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLT IWEERGRPIAGKGRKESAQPPAHL*
GeneID:
9973
Remarques:
Gene Accession: NM_005125
Add. information Mouse polyclonal antibody raised against a partial recombinant CCS.

Antibody Reactive Against Recombinant Protein.
Applications ELISA,WB-Re,WB-Ti
Stockage 50 % glycerol
Presentation
Conjugation:
None
Purification:
Serum
Buffer:
50 % glycerol
Pureté:
Serum
Format:
Serum
Specificité
Espèces:
Human
ID Gène 9973

Accessory Products

Protéines et/ou Positive Controls

Protéines pour CCS / SOD4 (8 produits)

N° du Produit Espèces Presentation Pureté   Source  

CCS / SOD4 (1-274, His-tag)

CCS / SOD4 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / 750,00 €
  OriGene Technologies GmbH

CCS / SOD4 (1-274, His-tag)

CCS / SOD4 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / 300,00 €
  OriGene Technologies GmbH

CCS / SOD4

CCS / SOD4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CCS / SOD4

CCS / SOD4 Human Purified
  Novus Biologicals Inc.

CCS / SOD4

CCS / SOD4 Human Purified
  Novus Biologicals Inc.

Positive Controls pour CCS / SOD4 (2 produits)

N° du Produit Espèces Presentation Pureté   Source  

CCS 293T Cell Transient Overexpression Lysate(Denatured)

CCS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CCS overexpression lysate

CCS overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn