TA338367 CACNB3 anticorps

Rabbit Polyclonal Anti-CACNB3 Antibody

See related secondary antibodies

Search for all "CACNB3"

0.1 mg / 300,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Vue générale rapide

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CACNB3

Description du Produit CACNB3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CACNB3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit CACNB3

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 mg
Synonymes CAB3, CACNLB3, Calcium channel voltage-dependent subunit beta 3, Voltage-dependent L-type calcium channel subunit beta-3
Presentation Purified
Reactivité d'Espèce Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur OriGene Technologies, Inc.

Extrait de la Fiche Technique

Swiss Prot:
The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the C terminal of human CACNB3. Synthetic peptide located within the following region: EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPH.
Applications WB
Sujet This gene encodes a regulatory beta subunit of the voltage-dependent calcium channel. Beta subunits are composed of five domains, which contribute to the regulation of surface expression and gating of calcium channels and may also play a role in the regulation of transcription factors and calcium transport. [provided by RefSeq, Oct 2011].
Protein A purified
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Protéines et/ou Positive Controls

Protéines pour CACNB3 (3 produits)

N° du Produit Espèces Presentation Pureté   Source  


CACNB3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.


CACNB3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


CACNB3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive Controls pour CACNB3 (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

CACNB3 293T Cell Transient Overexpression Lysate(Denatured)

CACNB3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn