discontinued

NBP1-94080 C20orf177 anticorps

See related secondary antibodies

Search for all "C20orf177"

Vue générale rapide

Rabbit anti Human C20orf177

NBP1-94080

Plus de vues

  • NBP1-94080

Description du Produit C20orf177

Rabbit anti Human C20orf177.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Caractéristiques du Produit C20orf177

Type de Produit Anticorps Primaires
Quantité 0.1 ml
Presentation Aff - Purified
Reactivité d'Espèce Hu
Applications P, WB
Clonalité Polyclonal
Hôte Rabbit
Isotype IgG
Destination Not USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q9NTX9
Immunogène:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SSKSTKLQRWDLSGSGSSSKVETSGHIRVPKQAAVILDSADSCKASKTQAHAHPRKKGKAESCGHATVSSEKKLKTNGVKQ
GeneID:
63939
Stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Presentation
Purification:
Affinity purified
Buffer:
Phospate buffered saline, pH 7.2, containing 40% glycerol
Format:
Aff - Purified
ID Gène 63939

Accessory Products

  • LinkedIn