discontinued

H00284029-B01P C17orf44 anticorps

See related secondary antibodies

Search for all "C17orf44"

Vue générale rapide

Mouse anti Human C17orf44

H00284029-B01P

Description du Produit C17orf44

Mouse anti Human C17orf44.
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit C17orf44

Type de Produit Anticorps Primaires
Quantité 0.5 mg
Synonymes FLJ34790, MGC104931
Reactivité d'Espèce Hu
Applications WB
Clonalité Polyclonal
Hôte Mouse
Destination Worldwide
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q8NAT9
Immunogène:
C17orf44 (AAH89396.1, 1 a.a. ~ 148 a.a) full-length human protein.
Séquence AA:
MILASGARGPGFKSRTSPPLPFTETRVSSRNMLPDQRCRRLDCKSSMYSKLFCGTAVAESISIPRPAWHVRKRRGT PRLGQVPPFLLPDFLPGVSTRPPQPGFALIDTRQSIVVDDSVRESPGTVKTWFSAVLKALCLFRSLHLTIGA
GeneID:
284029
Add. information Mouse polyclonal antibody raised against a full-length human C17orf44 protein.
Stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Presentation
Buffer:
In 1x PBS, pH 7.2
Specificité
Specificité:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn