discontinued

H00388284-B01P C16orf86 anticorps

See related secondary antibodies

Search for all "C16orf86"

Vue générale rapide

Mouse anti Human C16orf86

H00388284-B01P

Description du Produit C16orf86

Mouse anti Human C16orf86.
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit C16orf86

Type de Produit Anticorps Primaires
Quantité 0.5 mg
Synonymes -
Reactivité d'Espèce Hu
Applications WB
Clonalité Polyclonal
Hôte Mouse
Destination Worldwide
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q6ZW13
Immunogène:
C16orf86 (AAI32881.1, 1 a.a. ~ 223 a.a) full-length human protein.
Séquence AA:
MVQRESLSSEGALGGKELQPRGWGTHHSRIPKSCTPAGRILVPSHYHHSPPVPQEPPCREQQESGSFRACRGLGSL ASKPLGPGVSLTRNGTGVEPWGCGQAGLFPGPGNGSQGWSLAQVSCPWLRSLSLPGLRAHLKAEAELPPKLPLQEE EPEDSQSEPSPSAKQHKKAKKRKSLGAPVLHAVASMVSAPLETLRLEREWQSLDCSFSPCLWGPTWHNLAL
GeneID:
388284
Add. information Mouse polyclonal antibody raised against a full-length human C16orf86 protein.
Stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Presentation
Buffer:
In 1x PBS, pH 7.2
Specificité
Specificité:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Protéines et/ou Positive Controls

Protéines pour C16orf86 (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

Chromosome 16 open reading frame 86 (C16orf86)

Chromosome 16 open reading frame 86 (C16orf86) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

Positive Controls pour C16orf86 (1 produits)

N° du Produit Espèces Presentation Pureté   Source  

C16orf86 overexpression lysate

C16orf86 overexpression lysate
0.1 mg / 280,00 €
  OriGene Technologies, Inc.
  • LinkedIn