discontinued

NBP1-69711 BAP29 anticorps

See related secondary antibodies

Search for all "BAP29"

Vue générale rapide

Rabbit anti Human BAP29

Description du Produit BAP29

Rabbit anti Human BAP29.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit BAP29

Type de Produit Anticorps Primaires
Quantité 50 µg
Presentation Aff - Purified
Reactivité d'Espèce Hu
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Destination Europe only
Fiche Technique Télécharger la fiche technique
Fournisseur Novus Biologicals Inc.

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
A6NCU1
Immunogène:
Synthetic peptides corresponding to BCAP29(B-cell receptor-associated protein 29) The peptide sequence was selected from the middle region of BCAP29. Peptide sequence GVMEPQQRNADSHQKLEEAKNRFFPRASSSRSMALQIPIKLILDFLASRT.
GeneID:
55973
Sujet BCAP29 may play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. BCAP29 may be involved in CASP8-mediated apoptosis.
Stockage Store at -20C. Avoid freeze-thaw cycles.
Presentation
Purification:
Peptide affinity purified
Buffer:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Format:
Aff - Purified
ID Gène 55973

Accessory Products

  • LinkedIn